DPCstruct | MC22734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 320 ± 45 aa |
| Standard deviation of domain lengths | 45.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7MX40 | 9-291 | SASYETLEYDLKQLSGKLEDLLEENQALDDTHRLPVTEFTVTPRRVAALQDQLLQQESGVVREVERERLLRLLQCHHLKNAAWDNLE… |
| A0A401Q1A2 | 38-376 | ASYLTPGTYSVSSQSNQSISSSIRSFYNVDVGVSSESTWLETKLAEAIEKDNRKHSEAKAKLKHGIKKLRGTIKRMMLENETVPVIE… |
| A0A182JKP7 | 42-442 | None |
| J9KMG3 | 26-360 | None |
| A0A3Q2VWC6 | 278-540 | None |
| D3ZXR2 | 900-1272 | None |
| A0A212C3H5 | 38-407 | None |
| G3ILL8 | 111-398 | None |
| A0A1Y1L1Z0 | 79-458 | None |
| A0A5J4NHV4 | 365-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.