DPCstruct | MC22733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9UGK1 | 65-131 | PTRDSWEKFYAEIGSCSVYNNDRLVDDLLTDLNQAAIKAVHIMDGGTQAKLVFTFENDKQAVFKPMR |
| A0A401PXN7 | 2-62 | KFFLGINRYELYSRNSTIVGSLLRELSTGKFVRVVQKLGGTQLKLTITLQDYGKVLFKPMK |
| A0A2T7PXW5 | 18-95 | None |
| A0A6P3XSF3 | 508-585 | None |
| A0A6J0UYQ6 | 225-297 | None |
| A0A0L0CQ13 | 303-373 | None |
| A0A0R3R754 | 119-185 | None |
| A0A811KLD3 | 123-217 | None |
| A0A0Q9X9T4 | 362-439 | None |
| A0A2G9S4S7 | 60-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.