DPCstruct | MC22730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7QA06 | 403-462 | YKYDIFAAFPCCVQRLTCFQCSATVMDLDAAGNESFSCFSEEKECPQCRTRAYHFIKPLK |
| A0A401PT45 | 1-68 | MYTYDILAASPCCQARLNCKHCGKPVIDVRVGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY |
| A0A6P8R530 | 253-320 | None |
| A0A7M7GJ60 | 565-623 | None |
| A0A6A4VRV4 | 242-301 | None |
| T0MHX5 | 360-427 | None |
| A0A1W7RAG0 | 360-427 | None |
| A0A6P8Q634 | 337-404 | None |
| A0A177B4F4 | 485-561 | None |
| A0A835P484 | 399-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.