DPCstruct | MC2273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 99.52 |
| Assigned Pfam label(s) | CL0059- PF13966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350Y4W5 | 614-732 | GEALQKSILFYEAQRSGDLPDTNRVTWRGDSGLNDGADVGLDLTGGYYDAGDHVKFGFPMASSMTLLGWGAIEYYDAYAQSGQLPYI… |
| A0A6V7QBZ5 | 25-145 | ASSSSLDYADALEKSILFFEGQRSGKLPADQRMTWRGDSALSDGSANHVDLVGGYYDAGDNVKFGFPMAFTTTMLAWSVIEFGDKMQ… |
| A0A256W8C5 | 169-324 | None |
| A0A565C7L6 | 309-441 | None |
| A0A3B9IW87 | 17-182 | None |
| A0A0D3C5H9 | 52-238 | None |
| A0A7R9AR00 | 225-365 | None |
| A0A1E5V4J6 | 16-185 | None |
| A0A383WL42 | 10-129 | None |
| A0A6A2YWZ6 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.