DPCstruct | MC22728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 191 ± 37 aa |
| Standard deviation of domain lengths | 36.86 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4EW16 | 224-432 | GTVINQPVVILRDPAALEQEKLEREEQERRKALQLYVFVMRCIAYPFYSKPPTDLIRRYLKITKQQLNTFKERFQAFLSGELDVVGD… |
| A0A401PK29 | 26-201 | TQVEKVVKKAYGMLAFIGRGIEYKNWQLNKQQLQVVKERFQAFLNGETQIVADEAFWNAIQSYYESFLKSDRVARMVHSGGCSANDF… |
| A0A183MT02 | 23-183 | None |
| A0A5K4F7R2 | 258-480 | None |
| A0A183J6C6 | 23-187 | None |
| A0A183LFJ6 | 192-427 | None |
| A0A819NB31 | 182-414 | None |
| A0A1Y1NF41 | 91-319 | None |
| K1P853 | 1-271 | None |
| S9XDD7 | 29-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.