DPCstruct | MC22727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9A498 | 58-178 | YMTGKLLLKLDTVNFIISNHTREHFPFLEEHRCSRSRTTFYYTIGWLIFMEDSHVKFKSSMEPLLKVFIALESTPDAMFRTDTVKYS… |
| A0A4D9F2H7 | 1-128 | MDGKNTHSVRQYAVKFMLQNHTSKHFPFLGVNDNYSLSDLRCRTTFYTALTRLLMVDLGEDEDEFENFMLPLTVSFETVTQIFNNSF… |
| A0A453ERI8 | 1-133 | None |
| F7B593 | 303-415 | None |
| A0A401STW4 | 1-111 | None |
| A0A453ERD9 | 263-379 | None |
| A0A0S7KL32 | 106-232 | None |
| A0A4S2MC79 | 552-686 | None |
| A0A6P5QKX4 | 623-751 | None |
| A0A6I9XIM8 | 458-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.