DPCstruct | MC22726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 208 ± 19 aa |
| Standard deviation of domain lengths | 19.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF15019- CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VTU3 | 566-770 | WLAQFSDPSTLPASRLCLSYTQWPFHPGLFIQGIVRSSNGEVNLSAQKLIQSSRPLTVVDVNRGTVKQTGPPDLHARRNSSALRQEL… |
| A0A401PEL2 | 1-235 | MVHTLCLFLTPTEQKCSRLANASDSFKYDSGLFVQGLLKDATGSFVLPFRQIMYAPYPTTHIDVDVNTVKQMAPCHEHIYNQQSYMS… |
| A0A1X2G2V9 | 12-198 | None |
| A0A4U8US09 | 126-339 | None |
| A0A0N4VKX0 | 76-281 | None |
| A0A0N5A4A1 | 458-662 | None |
| K1Q5M3 | 132-334 | None |
| T1F197 | 503-685 | None |
| N1PB17 | 256-476 | None |
| A0A6L5D545 | 174-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.