DPCstruct | MC22724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671QXH4 | 162-263 | VTELKRCDNLRVFKLGLLSGLWWTLALVCWISDRIFCEMWSSVNFPYLHCAWHILICLASYLGCVCFAYFDAASEAPEQGPVVRFWP… |
| A0A401PB78 | 10-104 | CENVRVYKLGLLAGFWWALALLCWISDNLFCELWSAFNFPYLHCAWHILICLAAYLGCVCFAYFDAVSEIPEQGPVIKFWPSEKWAF… |
| F1LH73 | 19-117 | None |
| A0A151X5V1 | 290-394 | None |
| E4YV07 | 65-161 | None |
| A0A817TKA1 | 3-90 | None |
| A0A6S7KU08 | 83-196 | None |
| A0A816TWE9 | 711-805 | None |
| A0A1W4VJ70 | 2-101 | None |
| A0A7J5XEQ9 | 181-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.