DPCstruct | MC22722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 128 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 60.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3SBN3 | 1-129 | MKRGMKALRQLREKSKKRGVDDVESDRSDPSSFDHALSHLQQSLAHLDTLGHAFVLSLKDSNQERLQSYSRTYDLSRSERSKVQALA… |
| A0A7J8FK49 | 177-306 | RMAIKAVKHFIEKSRKRNLEENIQEANGSEMTYVDALNHLEKSLAHLETLNHSFIVSLKNSEQEILQKYCKLYDLSRSESGKLRDQA… |
| Q9D3Z9 | 3-132 | None |
| A0A5C6NPW2 | 129-254 | None |
| A0A444UPB0 | 6-115 | None |
| A0A822F1Z9 | 80-203 | None |
| A0A2I0TQ90 | 595-735 | None |
| A0A834A8M7 | 218-346 | None |
| A0A834A3N7 | 1134-1264 | None |
| A0A7J8E3I3 | 3-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.