DPCstruct | MC22721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 216 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0IHV3 | 1-243 | MEHSEAEVDMIHQKVRAILRGLDGQHPALQSDHGMLRWTLHKSLDRNPASGSVIVGILIKELEKAERSDTLHYIIPLLHTLMYTITK… |
| A0A1S3S3S5 | 1-214 | PPFLLKGEVKRVYLSYIVCLSECFAGLCINRWSLEELVKRDPRNFIILLQQILRKTREVLEQSQDELVVPLALLFSSTLLQTPHFSP… |
| A0A2K6P314 | 1-239 | None |
| S7Q3M4 | 4-186 | None |
| A0A6P9AYE9 | 1-215 | None |
| A0A4Z2B1H4 | 8-220 | None |
| L9JV47 | 26-256 | None |
| S4R547 | 1-221 | None |
| A0A6G0J8B6 | 11-216 | None |
| A0A6A4T5S7 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.