DPCstruct | MC22720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 195 ± 29 aa |
| Standard deviation of domain lengths | 28.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834B251 | 193-449 | ISWLQGDDVAVRAHFTEVERVPKALEVTESPLVKAVLHTCRAMHAALPGKADGQQSCFCHCEWASGHLWSSLNVSGATCDPALNHVV… |
| A0A1S3S213 | 3-210 | TKPENCQLSLSHSEKASGLLRDGLNLGPHCHSSSLDKVVQLLLCDLLLVMRTNVWRLQQSSSPGGLSLQASPAELHGFQQDLSSLRK… |
| A0A2D4P1Y2 | 51-259 | None |
| A0A0L7KIX8 | 51-208 | None |
| A0A2G9RLV9 | 1-181 | None |
| A0A7J8JM79 | 397-607 | None |
| A0A023FPG7 | 232-378 | None |
| A0A0L0CRY7 | 737-947 | None |
| A0A674MW07 | 689-894 | None |
| A0A1Y3AMY2 | 168-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.