DPCstruct | MC2272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7Q3J3 | 78-131 | MLAIVCKTYEGVKALEKHDNEGMIDTNAGLYGLGPPIGRLLNGRFLVLCLEKLS |
| A0A5P1ER57 | 134-196 | SRLLSEFLGLETMLAIVCKTYEGVKALERYDKEGMIDKSSGLHGLGLSIGRLVDGRFRVICLE |
| A0A843UG44 | 526-594 | None |
| A0A6A2YC28 | 1-52 | None |
| A0A6V7PY51 | 79-127 | None |
| A0A4Y7J9Q8 | 696-754 | None |
| A0A6A2Y0N8 | 1-54 | None |
| A0A5P1F3N4 | 215-274 | None |
| A0A067K094 | 20-83 | None |
| A0A7J0ECF5 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.