DPCstruct | MC22719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 219 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7QZJ8 | 64-255 | ADVQPVLDMFTHQNPRDHETWETRYMLLLWLSVACLIPFDFSRLDGNLVTQPGQTRVSIMDRILQIAESYLVVSDKARDAAAVLVSK… |
| A0A1S3S0C3 | 1-245 | TWETRYMLLLWLSMTCLIPFDLSRLDGHLTSDPSQTREPIMDRILAIAKSYLMVSDKSRDAASVLVSKFVTRPDVKLKRLGDFLDWS… |
| A0A1I8FH57 | 329-573 | None |
| M7AHE1 | 638-861 | None |
| A0A452YM90 | 148-348 | None |
| A0A158Q3E8 | 155-375 | None |
| L1J4H8 | 93-285 | None |
| A0A1I7ZMN7 | 1-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.