DPCstruct | MC22718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 140 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9SEU4 | 26-157 | HTLKYYYWIVNPQDRSGIIPKGLDGLRPNQKEILSLRAFLLIFIKQLVMKDYGVKEDELQAILNYLLTIHEDDNLMDVLQLLVALMS… |
| A0A1S3RNB8 | 17-131 | SGITPKGLDGPRPSQKEIVSLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDDNIHDVLQLLVALMSEHPASMIPAFDQRNG… |
| A0A0K0EAS9 | 753-888 | None |
| A0A1I8I778 | 787-988 | None |
| A0A822D685 | 28-185 | None |
| A0A822E4L9 | 1-122 | None |
| A0A2G8LA92 | 547-703 | None |
| Q19317 | 694-856 | None |
| A0A2G9SD36 | 1-171 | None |
| A0A0V0XHR6 | 627-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.