DPCstruct | MC22716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 71 ± 13 aa |
| Standard deviation of domain lengths | 12.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9P6X2 | 8-67 | LTRFERTRLISARSFQLSLGAPPLIKTEKGETMLDVAKRELLEKKIPLAVLRRFPSGEVN |
| A0A1X0QJ37 | 7-80 | KKTSNQITIYEYAQVLGYRAVQLSNNSKPLVDTEGMTDCLEIAKKEYKEGKIPYIVRRILPDKSYEDWNLSELH |
| A0A6V8HIJ3 | 100-184 | None |
| A0A835NSR7 | 58-131 | None |
| A0A7C4GL34 | 25-96 | None |
| A0A842KA53 | 1-53 | None |
| A0A2H9L664 | 5-67 | None |
| A0A0P9E924 | 2-57 | None |
| A0A0H5BHN6 | 26-108 | None |
| A0A2D3UNN8 | 81-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.