DPCstruct | MC22715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5QZ82 | 136-222 | QRLIAYQVGDNDIVAAYDPSGAIEVLCTYNGYELDEFTVNEVVAVSDALLDSTEAFDQDEGKTVPLEKTLRQELDELTEPAYLHGWE |
| A0A0N9VZP9 | 1-88 | MPEENVLKCYAVGDCDFVAAYDEAGSIAVLANTNGDEPINYAAWDVELVSEEELDKPWCNEDDRTKIIGNLREWLAAATEPTWLAGTE |
| A0A1G8CTH4 | 358-443 | None |
| A0A1B8TC72 | 12-107 | None |
| A0A7Y1BAK4 | 30-105 | None |
| A0A3D0JUK1 | 247-333 | None |
| A0A5S3XED3 | 176-255 | None |
| F2KJL0 | 80-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.