DPCstruct | MC22714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 373 ± 88 aa |
| Standard deviation of domain lengths | 87.99 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554VB01 | 2-277 | FFTIAQKSLLNEDNGKLLGYLSDRNLRKGITLVRNFFTSGHIQADRALNNYINGQADFTFPYHEVFKGSILGTWRYFKDERAEAINI… |
| A0A0N8NY46 | 3-312 | KRLIFAVRVAEGKVAPAALQGIRLNLKNVVLFLNATLRSIRTSDSIKQFLSNVTGGNTRSVIELITGFFGSPNVDSQKIVNIEEEKG… |
| A0A7U9BDI1 | 36-352 | None |
| A0A511FSJ7 | 36-375 | None |
| A0A3D2HD37 | 98-693 | None |
| A0A0F9W517 | 151-600 | None |
| V7FS71 | 4-227 | None |
| A0A4V3CSY2 | 239-628 | None |
| A0A2W4X8A3 | 75-470 | None |
| A0A7R7GBN7 | 434-809 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.