DPCstruct | MC22713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 292 ± 57 aa |
| Standard deviation of domain lengths | 56.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IHP2 | 6-303 | EVTYLRIHADPAGTSLFANGQMQVAANILIKAIDPTNNADYNLTPAELASIQLVDYYNTEEVLTGNWTYTTIENDFSHTMPSNGFSR… |
| A0A1I0D1K4 | 18-278 | WTSLSWFQVQYLQRPEDNTVATVYRNGRQQVPITILVEARNSDNEVVPLPNQDLLNIKLVNYNTGLPWSNGVTVSNTRNPNYDYFPE… |
| A0A1C7Z315 | 36-249 | None |
| A0A369KW43 | 31-376 | None |
| A0A379JCV6 | 1-246 | None |
| A0A378RJQ5 | 226-528 | None |
| A0A095T893 | 7-211 | None |
| A0A3M3ET84 | 478-825 | None |
| A0A364JXR5 | 16-358 | None |
| A0A077QPN0 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.