DPCstruct | MC22712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 202 ± 34 aa |
| Standard deviation of domain lengths | 33.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 65.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3I425 | 13-184 | EAGYIEIMKNCSNWNSRIETERKGRYPVLDAQTGIAQRPSQYAPITFASRYPPSSPSQVCTYMSQRWRKRSAAPSSDATEMKYIVQC… |
| A0A820GX01 | 1-195 | MISSTTSPIIIPVSSIIRVLGRNYDESILLTSKYNQSILRDRRRRQSSTIDNQTGIQQINSSLFHKISDRMSITRPDQVYVYPRRSY… |
| A0A158QF45 | 1-162 | None |
| A0A3P7M309 | 6-197 | None |
| A0A4U5MPX7 | 1-265 | None |
| A0A5B7ITE7 | 2-160 | None |
| J9EUA7 | 4-223 | None |
| A0A6P7Z008 | 6-203 | None |
| V9LBI2 | 1-212 | None |
| H3B0B5 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.