DPCstruct | MC22711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 152 ± 6 aa |
| Standard deviation of domain lengths | 6.06 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0497- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9E4J0 | 233-382 | HETNLEELAKELEKRWDDIIAKLEALRSELSILQPQNKTEERNEENEEIRMVIFANPVHPPYSVLVLLKLLSQSYNVSSTSHLHSSI… |
| A0A6A4X4S5 | 11-168 | ARPDPRLVRLERRQQAVLDELAGLGLMLDECRQRRGLAPRSAAPAAAGPPPERLRLAVYAAPDRPPLSVGLLCRLLATHAPVWCRAH… |
| A0A6I9WRP4 | 75-223 | None |
| A0A6A4W849 | 16-171 | None |
| A0A7R8D219 | 610-760 | None |
| A0A7R8Z9U5 | 582-726 | None |
| A0A210QCM3 | 277-440 | None |
| A0A7R9ARW4 | 342-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.