DPCstruct | MC22710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 272 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2N0J1 | 6-280 | LMAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPMKCFLDFKS… |
| A0A820FD80 | 237-490 | MSIIRPKNAYPNVKYFESIEILNQFDIIRKNLVKKNFHIDPNYLTKENIAEIIIQLVHLQEDLLGQQSNKQITRIPMKCFLDFHETG… |
| A0A6P7GRZ5 | 1-222 | None |
| A0A830HP99 | 33-259 | None |
| A0A183K8Q2 | 1-285 | None |
| A0A1I8I236 | 1-354 | None |
| A0A0D2NUX5 | 3-270 | None |
| A0A7S1PGU9 | 11-287 | None |
| Q550R6 | 22-359 | None |
| A0A818DEV7 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.