DPCstruct | MC2271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.00 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | CL0187- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397KZW1 | 2-82 | ALTCRDTLRLIFQRLTVADLARASCVCRVWNSVATENDLVASAFTAPWRIKDLVGKPASGAFWRDNGIWKFAISHRISRGD |
| A0A6V7Q3G6 | 1-88 | MNSHFSALSSGDLLRSILACLPPADLARAACVCRLWRALASDREMLERAFRAPWRVRRVLGTPSSAAFWRHPALSRFAISHRLLRGDT |
| A0A4U5NP11 | 1-90 | None |
| A0A6D2L748 | 247-347 | None |
| A0A2I0W2D6 | 496-596 | None |
| A0A7J0F0F3 | 44-146 | None |
| A0A5A7RCR9 | 50-136 | None |
| A0A811ML47 | 1-86 | None |
| A0A287NDN8 | 20-96 | None |
| A0A2K1R8J2 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.