DPCstruct | MC22709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 153 ± 25 aa |
| Standard deviation of domain lengths | 24.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ET51 | 41-208 | YILNDFISHINQFNNEKKKSFYSITLIFLQFDKTLAPLVGKLLIKIAQNKEDIEDGLKILEENLSKNYFERILTELSSFIKKTDSCP… |
| A0A819HB98 | 181-346 | IQDVFKNLNSHVTTFDKEKKIAFRSITPIILQFDKTLAYDLSIILIGIAESKEDLEDILKNLEENLPKDYFERILTELSTFIVNSQS… |
| A0A814XR74 | 342-499 | None |
| A0A816RJU8 | 25-139 | None |
| A0A815F3E3 | 551-719 | None |
| A0A818VBW7 | 2-113 | None |
| A0A820MRK4 | 40-172 | None |
| A0A820KQY4 | 36-172 | None |
| A0A814Z536 | 614-809 | None |
| A0A819URR1 | 660-828 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.