DPCstruct | MC22707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 42.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2B8P3 | 87-177 | KQMPVYEPLLDDYLWDYFQNPKTRRHLTDLGLVARDGTIIDHKDFKYAQIRLQKMEYERNILKQDQERILDREIEIAIRKKAKTDKM… |
| A0A820CW15 | 1-110 | MSAPIPPATPYCSLTDAHLQNHFTKNRIKQHLRRAGLLNRNGYIVTEAEYENRLMDIEIGRQNRRKYDEALLEVLIELGEEQYKLLC… |
| F7B255 | 1-119 | None |
| A0A1I8H3D6 | 1-97 | None |
| A0A813YMI8 | 1-106 | None |
| A0A834E5H9 | 1-102 | None |
| A0A6P8I8F9 | 1-113 | None |
| A0A7M3RY37 | 1-105 | None |
| A0A3Q2ZG30 | 1-119 | None |
| A0A3Q0DP93 | 173-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.