DPCstruct | MC22706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820BHX6 | 1-115 | PFLDIEALELSENDNLMAITSAGCNILTYVLQKPKHIYAIDRNPCQNAILELKIACIKELDFSTYWKIWGDGKLRRFSQDVYPRLTM… |
| A0A0M8NZH5 | 54-177 | FQNEYIYAFTWEDPRVDHRLLNIGTDDVILAITSAGDNILDYLQKSPRRVHAVDLNPNQNHLLELKVACYSALGHRDMWKIFGDGKH… |
| A0A0J6FHL7 | 163-266 | None |
| A0A7W1TYA8 | 3-128 | None |
| A0A2D7AEG7 | 8-136 | None |
| B4DCD1 | 15-142 | None |
| V5FYU2 | 408-544 | None |
| A0A6V8LVU3 | 24-143 | None |
| A0A5N6KLD2 | 419-528 | None |
| C9MWR1 | 12-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.