DPCstruct | MC22704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3DMM5 | 1-103 | MTDLKGKEVKRSTLNELVEYITNGRGVLTEPVYPEIIKMISVNLFRTLPPSENPDFDPEEDDPTLEAAWPHLTLVYELFLRFLESSD… |
| A0A820B934 | 25-177 | RLQESSRLGQKNFRPELEALPLLKETSADQQEKLFVAKLKQCCVIFDFSDCVSDLKSKEIKRACLNEIVDYITVTRNCLAENIYPEV… |
| A0A835HIC8 | 31-202 | None |
| A0A0D2MLB6 | 12-137 | None |
| A0A0G4NA49 | 139-331 | None |
| V6T7Y4 | 28-213 | None |
| A0A7J6S362 | 87-274 | None |
| A0A819Z0J3 | 41-204 | None |
| A0A2X0N4K4 | 86-250 | None |
| A0A2H2JMU3 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.