DPCstruct | MC2270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 144 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14085 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4T5M6 | 74-218 | LVAVILDDNNEQVYGKVKNGLAILERIPKPETGYFYLDIVKVVGPIGKQAFRDEEIEVFKAIEIYKSSNIPTFTFKAILPKPNDYFR… |
| Q1CWP7 | 2-108 | FQLDNVPFFAKGVACEDVVSAKDVDGELRFQKVVRPSGHATLRLIVHDEEDVPSVKELLEKHGCAVERSHVPGLISVDVPPTVPLDS… |
| A0A066YT57 | 2-134 | None |
| A0A1W9X7Y0 | 212-379 | None |
| A0A1F3IE73 | 27-170 | None |
| A0A810LYW4 | 8-126 | None |
| A0A087KBT4 | 1-116 | None |
| A0A522QQR9 | 1-118 | None |
| A0A5J6ME46 | 105-246 | None |
| C7PGU5 | 8-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.