DPCstruct | MC22697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2HSX6 | 9-117 | KEFIMKKRGEILSELGDYLKEIKHDMSVDQILAAVKNDDDDEAFDEMVIMLSESDDVPDSETAQEFAMELFNYFPRKSFGGKSLAEK… |
| A0A1F9FSQ3 | 4-91 | ESKQQIFEYRKELEQELEDMLRVTESDFSLQDVKDAIFYEEDNDDMMKVVMMFDKGNPLELSNAIELVTDAWNYFPHKILDGMSPVEK |
| A0A7V5NAR5 | 88-178 | None |
| K1ZLL2 | 206-299 | None |
| A0A0G1JS96 | 143-230 | None |
| A0A1G2QZV6 | 1-109 | None |
| A0A554LDP9 | 100-189 | None |
| A0A1F5JCG0 | 1-109 | None |
| A0A1F6NWT7 | 50-140 | None |
| A0A554JWB0 | 7-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.