DPCstruct | MC2269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 130 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352NA26 | 23-149 | SIKLTVEAAVKAGVSLSYANLYSANLVRANLDSANLYSANLDSANLNGAKYGDFTIKKLPIQISNIGYYVLIFETHMKIGCELHTHD… |
| A0A463NP89 | 1-145 | MKQEELDIILENHGKWLFNEGGDRADLSNADLKNTNLRFANLRLADLRGANLSYADLNGADLNGADLNWINWRDVVSLTVIAVQINT… |
| D8K8E7 | 46-178 | None |
| A0A0R1VXT1 | 1-119 | None |
| A0A2N0X911 | 1-132 | None |
| A0A4V2DNP5 | 69-202 | None |
| W7BJX2 | 3-150 | None |
| A0A2V4EIG7 | 2-139 | None |
| A0A7Y0L1R3 | 1-130 | None |
| A0A7X0WH19 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.