DPCstruct | MC22688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 299 ± 32 aa |
| Standard deviation of domain lengths | 32.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1M9Z4 | 37-299 | AFWANLSSDALSVFSDDDVALLKKVYNPSLSDRRQEGDRFVPPDTSFASVQKLRALVQEEELVQKHRKNNFFGKGFSASEPGPLFPA… |
| A0A7S4SP43 | 1-258 | KEDRSLLQNVFNPSLCDRREEGNLFMPPDTSFAYVQSLRQLVKEEEAVRKDRKQEFCADGFDHEAPGLLFPTSWRSSAKLSPKGAAG… |
| A0A7S1RU35 | 221-537 | None |
| A0A7S1RU27 | 259-547 | None |
| A0A7S2LXE7 | 1-288 | None |
| A0A813BJJ8 | 310-609 | None |
| A0A7S1W2R2 | 24-303 | None |
| A0A7S2C9C6 | 37-320 | None |
| A0A812RUE4 | 335-659 | None |
| A0A7S2GZW9 | 413-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.