DPCstruct | MC22686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 111 ± 24 aa |
| Standard deviation of domain lengths | 24.04 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1M3E7 | 82-192 | SAETTPASEASPSPPADSQCGQSPFMLPVPLDLAASLDSPLPSTGSALHASGKCRPCAWFWKEKGCLNGQACAHCHLCPEGELKNRK… |
| A0A7S2J1G6 | 2-83 | GRAAQPLSLDGAVERAARGTPECPSVGSAGHWLGMCKPCDFVHRGLCTNEAACKYCHLCGPQEGKVRKQQKKALARAAKQWQ |
| A0A812Q445 | 7-173 | None |
| A0A1Q9EAA4 | 222-337 | None |
| A0A1Q9E6E6 | 232-328 | None |
| A0A812R9Y3 | 182-294 | None |
| A0A812UFM8 | 975-1068 | None |
| A0A7S2NZH4 | 20-132 | None |
| A0A812SKE8 | 329-427 | None |
| A0A812VVM5 | 314-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.