DPCstruct | MC22685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 19.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.90 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2K3C5 | 15-143 | SPRGPGRGRSPLPPPRKVVSPSPEKRDTDWRGRKKEDAAPGGDAGGEAGDQEVVMKVVDGAPNRAGDATWLAEVYVPRPPPMRPGTI… |
| A0A7S1LYF3 | 6-140 | GREGDRHRDDDRSRSRGHEGDRRDDRDQRGGDRDRPRDRDDKDGGGEDSFRSSIEGPGATPPSRNAENCYRAVVEMKKPGDRAGTLG… |
| A0A6T0U7V2 | 77-218 | None |
| A0A7S3RES4 | 78-211 | None |
| A0A7S0AS57 | 48-189 | None |
| A0A7S1F5T3 | 233-372 | None |
| A0A7S2ICZ1 | 1-114 | None |
| A0A7S1RPJ4 | 1-122 | None |
| A0A7S1A7F3 | 252-447 | None |
| A0A7S0FZM2 | 73-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.