DPCstruct | MC22684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 26.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813IUR0 | 4-149 | CYLKYRDLAIAKRWKGTPMIAFPAPTCALRSLEAECHKMMAGTGIKAGDHYCRPADKDIDDTCLHPPKDQNRPLAFQYILEDLQLDS… |
| A0A7S1LW58 | 1-213 | GYTDMGMKPFKHKYRLLDNYGNAVPEPNEDDLWKIEVYKNCLYCFFDVSSFVSLITVLAYLTFRFYVWSCYRKYRSLTMAMELQPNS… |
| A0A812QRA8 | 234-449 | None |
| A0A812Z0V7 | 1-217 | None |
| A0A7S2Q9I9 | 1-219 | None |
| A0A813AP87 | 48-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.