DPCstruct | MC22683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1LUB6 | 20-116 | EAVPSCVCGSTLRRVSRSDRVNRICETMWPGAPREELIAIILSGQCDVICDICANQVRTCSGVWTCDNGESTILHATAYDVCDACFV… |
| A0A813I299 | 194-295 | GESPACVCRSSLKRVTGLDRARHFCQRRVPDHPPGSRVFEEMLARITRNGRTSVICDLCEEVVMLGSGVWTCENSDSTILHATQYDV… |
| A0A7S1SDM3 | 19-131 | None |
| A0A7S2MAV2 | 1-98 | None |
| A0A7S2GV45 | 155-256 | None |
| R1E4C3 | 175-277 | None |
| A0A812KQA7 | 540-644 | None |
| A0A7R9ZWW7 | 186-319 | None |
| A0A7S1FHW6 | 152-245 | None |
| A0A7S1FB98 | 138-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.