DPCstruct | MC22681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 157 ± 24 aa |
| Standard deviation of domain lengths | 24.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4Q1A7 | 143-317 | SSAAVERRAEATPPTRSPATRTPAVMHPAATVPPAVPLPSTAPAAARPALADAERPRLQEEVSAPGTPSSQTSATAPGPSQAPPYRA… |
| A0A7S1LQN7 | 1-200 | SRGRAHCGFGGHGSGIAPVLDLAKMGFPDGVVPAGGSMQNSPFGTPRSGRSQSPGQSRLLHGAARRQDRERSRPLQEHEQRPALAAA… |
| A0A4C1U3J5 | 1-140 | None |
| A0A812X8H5 | 483-653 | None |
| A0A6P3WZ00 | 7-146 | None |
| A0A078AP58 | 1-168 | None |
| A0A7S3G3Q0 | 1-120 | None |
| A0A5N4ARL5 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.