DPCstruct | MC22680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 192 ± 40 aa |
| Standard deviation of domain lengths | 40.40 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 66.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4E8V6 | 281-469 | AVIASYLRGAARQQQQQQQQQQYQHTTYVQPTTLSSLSSVKVAPPVGSSVDPPPGFSPAGMVPRAVSMSLPSLPLLESNQAVLLAEE… |
| A0A7S1LEX7 | 1-207 | GRESPTAEWPATARAMQQHRVWGGVEVESSSGSASFAADRQRALKDVQWNSVSESEDSSLNSKEEYVDVNGTRVRIAEQKAQAVESA… |
| A0A812T9P6 | 105-282 | None |
| A0A812UFM8 | 922-1056 | None |
| A0A7S2NZH4 | 1-127 | None |
| A0A7S2P7F3 | 1-170 | None |
| A0A812R9Y3 | 76-314 | None |
| A0A813FIM6 | 196-387 | None |
| A0A812LWJ8 | 22-234 | None |
| A0A7J6PXU5 | 27-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.