DPCstruct | MC22679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2I7X9 | 129-238 | CTDNFQSCTHTHCCANDGFTCYRKRFAYAQCMRTGSCDPEKDGDCEPLASQLGQCKGAFSDCHLSACCQRGEDHCYLKNEGYGQCTP… |
| A0A7S1LDX4 | 82-228 | MHFHAGEAQGVAILAEENASAANGTNASAPTAWPHGTCSESWGDCLQSRCCVVPGQRCFRKNERYAQCRTACTLGLNDDDVNTAWWT… |
| A0A812WS11 | 298-440 | None |
| A0A812JN59 | 307-437 | None |
| A0A7S3RHI3 | 11-142 | None |
| A0A813BQ75 | 62-182 | None |
| A0A1Q9DYR7 | 497-649 | None |
| A0A813GII4 | 34-183 | None |
| A0A7S1RZ24 | 126-237 | None |
| A0A6S9X709 | 10-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.