DPCstruct | MC22677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 273 ± 52 aa |
| Standard deviation of domain lengths | 52.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05495 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7JTB8 | 2-213 | NREIQQLNEPGFEIFEVDSPNVYASITNVNTGIIYMKSLTAQVVCKQCQRNFTINRSKQCQCKNDLIYEFTPIFYHNNYVGRLEMSS… |
| A0A7S1L5J3 | 1-278 | GVEVRLVGLTLEGLDTLVVCALRLEVVCLRCRKPTDMSFEGGAGTEPRTATAPCPVCKQELAIRAAPNICHGGCPTVAYVIGVNCHP… |
| A0A0X3P2P8 | 46-338 | None |
| A0A1W0E5I6 | 164-395 | None |
| A0A1V9YD61 | 814-1131 | None |
| A0A7S3PPZ7 | 117-422 | None |
| A0A4Q7JWX8 | 773-1062 | None |
| C9SSR1 | 2-180 | None |
| A0A5J4UUB3 | 506-832 | None |
| V6LZA8 | 569-858 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.