DPCstruct | MC22676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812T648 | 87-191 | FMDTASPLGPTWEKACQGRAPTIDVPTGMLMGKWAECLAWAVAYEAQHPDWTSDRKFLLQTPAGQVIEAIEAVTVGSRRGPVVEASQ… |
| A0A812VHP4 | 941-1053 | AQTNTAFMDTAAPGGATWANYCQGPPEVNPSTGFVAGRWGDCLAWAVVYEHQNPGWPQNPTYRDMGPAGTVIQAMLENAEDSDCEDV… |
| A0A1Q9E218 | 520-610 | None |
| A0A813K9D0 | 1-112 | None |
| A0A812JFS8 | 549-660 | None |
| A0A1Q9E250 | 564-680 | None |
| A0A813FEI2 | 230-342 | None |
| A0A7S4W8P1 | 488-608 | None |
| A0A812UMS7 | 1012-1129 | None |
| A0A7S3WRX6 | 120-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.