DPCstruct | MC22675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 915 |
|---|---|
| Mean domain length (aa) | 309 ± 62 aa |
| Standard deviation of domain lengths | 61.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.70 |
| Pfam Score | 38.00 |
| Assigned Pfam label(s) | PF09249- PF20266- CL0511- PF20965- PF10421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317J1L7 | 7-177 | KVQASQALRALQIFESLSRYRPTFVGSTPIDLDLNESDLDVICEAYDLDEFEQHAKFVYGNRSNFTCIKVVKYSLPSILVSFFSHNF… |
| A0A7S1L4K3 | 95-404 | SNEAIQKIELTDQVYGGVHSRLGQGSTLQAVVQRLMAVCKQIEKASFLALEEVVLGGAAGKGLLAAPPQPQAEIVLFVRQLPSRNFA… |
| A0A6I9K717 | 10-339 | None |
| A0A1I8IQQ8 | 675-1018 | None |
| A0A1I8I251 | 11-228 | None |
| A0A0K0EE34 | 183-496 | None |
| A0A4S4D7A7 | 30-381 | None |
| A0A6I8PAE2 | 554-920 | None |
| A0A7R9NW40 | 98-397 | None |
| A0A7M5X7R9 | 161-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.