DPCstruct | MC22671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 167 ± 31 aa |
| Standard deviation of domain lengths | 30.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 54.17 |
| Assigned Pfam label(s) | CL0193- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7GGH5 | 84-254 | SVGSKNIGDPNPDWMASLLNEVQLGRSLRLRVLFDGTVGNDVLNFSRRILDIFATGRDAERELLPFGDPNKLPAGYLFARRNIFEEY… |
| A0A843ETY3 | 12-193 | EPDFIGGLTNNFTYKNWDFSFLFDFRKGGDILNGTEYLMTTYGLSKETENRGQTLTFTGKSLNPVTKEYETVTREVIATEKYYRDIY… |
| A0A645JSU5 | 7-141 | None |
| A0A7K3IX64 | 424-606 | None |
| A0A5Q5FR07 | 8-125 | None |
| A0A0P0GPS6 | 12-146 | None |
| A0A7K0I7C2 | 3-160 | None |
| A0A6L8UDS1 | 17-187 | None |
| A0A1F3NHX6 | 7-153 | None |
| W4PCW2 | 16-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.