DPCstruct | MC2267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4F2V1 | 5-129 | KQTAEKNASSLINFSLKYFDTDSKKFPCNCWDGVFYLNLFNRIKDLSSMQKLEFTSNRSRTLRSHPIEWHNTSENGFGFPMEEQIVD… |
| A0A4V3JRP9 | 58-184 | FDLPLQLDESRADHEGEWTWGTHRNWEKPGDSLEIIKAFRQNYVNKLWKEIFAEKYNYKKGTRQKHIYYPINKLCKEARQRLTELEN… |
| A0A246ID71 | 40-192 | None |
| A0A764W9S1 | 1-130 | None |
| A0A1Q9SR01 | 1-115 | None |
| A0A5A9C2M6 | 1-152 | None |
| A0A2N2BTX5 | 7-144 | None |
| A0A1X9SVX0 | 1-144 | None |
| A0A316PE49 | 5-154 | None |
| A0A4R7DYU2 | 20-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.