DPCstruct | MC22668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 150 ± 33 aa |
| Standard deviation of domain lengths | 32.95 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01976 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5HGY5 | 2-144 | RQSLIRLNNLVTRLRRPRVRPEQLLLLVPHCLQKKTCERNIRADIESCGRCGRCAVAAILELRDRYGIRVELVSGGRRAVAAARGSD… |
| A0A843EJH1 | 21-162 | SLVDNIGIEVRNKVNKSKFEKIPPEDKIIVLPHCLRSAQCEASLKETGVQCTYCGKCAIGIIKEKAEPMGYRVFIVPGSSFVKKIIQ… |
| A0A523DLY4 | 97-265 | None |
| A0A843GB05 | 1-103 | None |
| A0A7C0U419 | 3-204 | None |
| A0A6A2EX90 | 243-401 | None |
| A0A831KW87 | 237-424 | None |
| A0A1V6N523 | 340-504 | None |
| A0A800BQH6 | 1-223 | None |
| A0A7V0PN20 | 181-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.