DPCstruct | MC22666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2C2B0 | 1-64 | MWISTDWKDYELLDCGGGERLERWGKYLLVRPDPQAIWRPEGRHPGWRRHDARYQRSSTGGGQW |
| A0A843EFA2 | 1-69 | MELINNFDDYEIIDASNGEKLERWGNIYLLRPDPQIIWNTGDLREIYKDKIHAVYHRSNKGGGHWEELK |
| Q8YET1 | 85-146 | None |
| M3GYS7 | 507-574 | None |
| A0A7V4HVL0 | 152-213 | None |
| R5N738 | 1-65 | None |
| D9MX67 | 1-63 | None |
| D4IZH9 | 1-66 | None |
| A0A1Q9AEM9 | 133-192 | None |
| M3GE47 | 282-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.