DPCstruct | MC22662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0750- CL0213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8E232 | 15-144 | NICTGLWCSTGGSSLSLVIPADGTTCGNNMWCAGYSCVNDLLAPSVTERCMFGDTPFTPINGESCESYIKSQPWQCYVEDNFNKCCQ… |
| A0A8B6GYQ8 | 2-134 | CGLMWCRDITTQGCKSMVPADGTLCDSKHWCINGVCTYSSGAASTPAKCAHGDYVGSMDNRGNTCTQIVSKDKTECYRDRIGQSCCA… |
| R7TLI1 | 545-684 | None |
| T1ETK8 | 231-368 | None |
| A0A2C9KE57 | 1-141 | None |
| T1FHV2 | 246-383 | None |
| A0A812BK71 | 376-508 | None |
| V4AHG6 | 453-580 | None |
| T1FWF5 | 233-383 | None |
| T1FWF6 | 8-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.