DPCstruct | MC22661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1KX70 | 14-134 | GSSVNFNRINLPKEHLPYYLYNFPEILTQCQSDPECAYSDSAKDVCWGYEYNCTWDKQYSIPHCPGDHRGWVKTKYDQQNTFYTQAD… |
| A0A8B6GWZ3 | 9-128 | KSIYLFILTVDTVICFSWNTLNLPKEHIPYFFNNNPDIKEECKRDEKCPFQDSLSIQKCWGYEEKCPSDQRMIAPSCPGGSRGWAKD… |
| A0A7J7WCF4 | 42-159 | None |
| A0A1I7WMH2 | 167-313 | None |
| A0A834J3H0 | 1-115 | None |
| A0A3B4GCF7 | 17-134 | None |
| A0A7R9KCL1 | 573-723 | None |
| A0A4Y7LPB0 | 4-109 | None |
| A0A1Y1KX03 | 1-117 | None |
| A0A077Z4Y8 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.