DPCstruct | MC22659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 190 ± 38 aa |
| Standard deviation of domain lengths | 37.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 89.58 |
| Assigned Pfam label(s) | CL0084- PF21730- PF01813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0ZNG2 | 10-154 | LEDVCDLLDKLALTQLHLMEDKMRCELGIESSINNGSIHLAKSRYIMGQSSVSKERLPTESSPEFTASVACNTVEEDYIKQVKVVET… |
| A0A8B6GS75 | 9-199 | MDAVNKRLDEVLVEFFECVGELYQEQADLENIMKSGFLMMSRARYNMGAKSVGVSQYDENNMKASKLVLVTDKDDDDYVDKMFELVN… |
| M1V6N6 | 20-221 | None |
| A0A6J0TXP2 | 85-286 | None |
| A0A6P7FAS4 | 44-211 | None |
| A0A0R3TU68 | 169-348 | None |
| A0A120E8U5 | 9-240 | None |
| A0A2T4BU73 | 4-209 | None |
| A0A6G0XJX6 | 3-170 | None |
| A0A139ATX6 | 6-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.