DPCstruct | MC22658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 293 ± 42 aa |
| Standard deviation of domain lengths | 41.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6GKV1 | 1-315 | MLEESAITMEKKSNNRPSSAPQKQNGPESKKADNGNQNKYAKRRDTNSSKSYYQESSPRRPTPQKNKYAVDKRPRPRGGGGYPREDV… |
| A0A0A1UHE2 | 3-229 | RGRVQLEPQHYIYSHFQFSVFPNTDFSQAIRGRRVLYCDDAVTLTLPTTKKPICPICLDEVILPRLTACGHLYCWKCLLQFFVLCPA… |
| A0A158QG43 | 1-237 | None |
| A0A498NLB2 | 465-767 | None |
| Q38965 | 8-308 | None |
| A0A2H9TLA0 | 2-279 | None |
| A0A507CNL9 | 259-575 | None |
| C9S5Z5 | 1-383 | None |
| A0A1V8UPW1 | 28-353 | None |
| A0A392MFE4 | 11-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.