DPCstruct | MC22657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 410 ± 64 aa |
| Standard deviation of domain lengths | 64.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7VMU4 | 1-284 | MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKPCPDPAPVQLIVQFLEQASKPSVNEQNQVQPPPDNKRNRILKLLALK… |
| A0A8B6GFC1 | 6-430 | MPSDEMMRHTSMSMSSVSWFEFLLDEHKLDNHLQQQNPDPSPCQLIIQFLQQAEAHLAASTALVREIPTTPNGQNDSRSEDGNMHDK… |
| A0A212CEM8 | 14-500 | None |
| A0A6A4JTI5 | 1-416 | None |
| A0A813MV85 | 24-341 | None |
| A0A3F2RNW3 | 22-401 | None |
| A0A811VCZ2 | 5-449 | None |
| A0A5K3FW86 | 5-460 | None |
| F7AP73 | 4-354 | None |
| A0A815SN86 | 10-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.