DPCstruct | MC22656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 422 ± 101 aa |
| Standard deviation of domain lengths | 100.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 94.15 |
| Assigned Pfam label(s) | CL0023- PF12777- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YDA3 | 2-381 | ADKDENLKVRVANLIDAITYAVFIYTSRGLFERDKLIFTSQVAFLVLLMKKEINPTELDFLLRFPARPNCKSPVDFLNDLSWGGIKA… |
| A0A8B6GF01 | 25-522 | SLVIKLGDAIIPYHHDFKFYITTKMPNPHYTPEVSTKVTLVNFTLSPSGLEDQMLGIVVAEERPDLEEAKNQLIVSNAKMKQELKEI… |
| A0A0D8XQC7 | 619-926 | None |
| A0A183WFF4 | 32-363 | None |
| A0A2P8YMB4 | 657-1172 | None |
| A0A3P8DWB3 | 1-458 | None |
| A0A2K1INX7 | 586-1054 | None |
| A0A7S3G673 | 2-529 | None |
| A0A4Z2EPQ9 | 575-1045 | None |
| A0A812JA43 | 2-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.